PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009606533.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 822aa    MW: 89479.6 Da    PI: 6.6092
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009606533.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.72.7e-20128183156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++k +++t++q++eLe++F++n++p++++r eL k+l L+ rqVk+WFqNrR+++k
  XP_009606533.1 128 KKKYHRHTPYQIQELEAAFKENPHPDEKARLELGKRLTLESRQVKFWFQNRRTQMK 183
                     79999************************************************999 PP

2START1632.2e-513365601206
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela +a++el+k+a+ ++p+W++      e +n +e+ ++f++  +     +++ea +a+g v  ++  lve+l+d++ +W e++     + +t+
  XP_009606533.1 336 ELAFAAMNELLKLAEIGDPLWFRNFdgsgEALNLEEYARSFPPCIGmkpsnFTTEATKATGTVMINSLVLVETLMDTS-RWVEMFScivgRTSTI 429
                     57899******************9999999*************99999**9***************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     +viss       g lql++ae+q+ls lv  R + f+R+++q+ +g+w++vdvS+d  q+ ++  +   +++lpSg+++++++ng+skv+w+eh+
  XP_009606533.1 430 DVISSSasgsrnGNLQLIQAEFQVLSALVFvRQVKFLRFCKQHAEGVWAVVDVSIDTIQEGSQPREAGNCRRLPSGCIVQDLPNGYSKVIWIEHM 524
                     *****999*****************************************************998899999************************* PP

                     E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 171 dlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     +++++++h+l+r++++sg+ +ga++w atlqrqce+
  XP_009606533.1 525 EYDENTIHNLYRPFIRSGRGFGAQRWIATLQRQCEC 560
                     **********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.8E-22102187IPR009057Homeodomain-like
SuperFamilySSF466895.99E-20111185IPR009057Homeodomain-like
PROSITE profilePS5007117.734125185IPR001356Homeobox domain
SMARTSM003892.5E-16127189IPR001356Homeobox domain
CDDcd000861.51E-17128185No hitNo description
PfamPF000466.6E-18128183IPR001356Homeobox domain
PROSITE profilePS5084838.472327563IPR002913START domain
SuperFamilySSF559613.85E-28328560No hitNo description
CDDcd088752.19E-109331559No hitNo description
PfamPF018521.5E-44336560IPR002913START domain
SMARTSM002342.5E-35336560IPR002913START domain
SuperFamilySSF559614.81E-13605815No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 822 aa     Download sequence    Send to blast
MSFGGFIGSS SSGGNGGGDG GSGVSRVVAD SPYNNTMPTA ATIAHQSQQL VTSPLTQPMF  60
NSSPLSLALK PKMEGLGDMG MIGENFDAVA MGRSSREDEY ESRSGSDNLD GGASGDDLDA  120
PLGKSSRKKK YHRHTPYQIQ ELEAAFKENP HPDEKARLEL GKRLTLESRQ VKFWFQNRRT  180
QMKTQLERHE NALLKQEYDK LRIENIAMKE AMRSPMCGHC GGQAILGEIH IEEHHLRIEN  240
ARLRDELNRI CVLANKFLGR PLGSFPGAMP PGMANSGLEL AVGRNGFGAM NSADTALPMG  300
LDFGNGLSSP LTMMSPRPTP SMSSTDVSFD KSMLMELAFA AMNELLKLAE IGDPLWFRNF  360
DGSGEALNLE EYARSFPPCI GMKPSNFTTE ATKATGTVMI NSLVLVETLM DTSRWVEMFS  420
CIVGRTSTID VISSSASGSR NGNLQLIQAE FQVLSALVFV RQVKFLRFCK QHAEGVWAVV  480
DVSIDTIQEG SQPREAGNCR RLPSGCIVQD LPNGYSKVIW IEHMEYDENT IHNLYRPFIR  540
SGRGFGAQRW IATLQRQCEC LAVITSSAVP SGDSAVISPS GRRSIAMLAR RITRNFCGGV  600
CATFYKWEPI QTGTAEDTKL MMRKSIGDPG EPPGIVLSAT RTIWLPVTHQ RLFDFLRNEQ  660
TRSQWDVLSH GGPMHQIVHI AKGQDLGNSI SLFRANAASR DANQNSMLIL QDSCTDVSGS  720
IVAYAAVDTA EMNVVMSGGD SSCVAFLPSG FAIVPDCFQN SNNGMLEKED NGGSSNGSLL  780
TLGFQILVNS LPAAKLTMES VNTVNALISR TLQGIKTAFQ CN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009606533.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLM1B4R10.0M1B4R1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000370550.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein